|
|
Otomys irroratus - Vlei RatIUCN Status: Lower Risk/Least ConcernIUCN Species Profile http://www.ru.ac.za/academic/departments/zooento/Martin/hystrichopsyllidae.html Checklist: South African Hystricopsyllid Fleas (Siphonaptera ...: KwaZulu-Natal, Mpumalanga, Northern Province and Northwestern Province, to Zimbabwe; hosted by Otomys irroratus , O. tugelensis , Rhabdomys pumilio , Praomys ... http://www.ru.ac.za/academic/departments/zooento/Martin/chimaeropsyllidae.html Checklist: South African Chimaeropsyllid Fleas (Siphonaptera ...: Mpumalanga, Gauteng, Northwestern Province and Northern Cape, to Zimbabwe; hosted by Tatera brantsii , Rhabdomys pumilio , Otomys irroratus , O. unisulcatus ... http://content.karger.com/ProdukteDB/produkte.asp?Doi=56993 Karger Publishers: Chromosomal evolution in the vlei rat, Otomys irroratus (Muridae: Otomyinae): a compound chromosomal rearrangement separates two major cytogenetic groups RV ... http://content.karger.com/ProdukteDB/produkte.asp?Aktion=Ausgabe&ProduktNr=224037&Ausgabe=228256&searchWhat=books Karger Publishers: 253, Chromosomal evolution in the vlei rat, Otomys irroratus (Muridae: Otomyinae): a compound chromosomal rearrangement separates two major cytogenetic groups ... http://www.sles.und.ac.za/staff_academic.asp?RecordVAR=22 Academic staff: Otomyinae (Muridae). 6: immuno-electro-transfer of liver proteins of some Otomys irroratus populations. Tropical Zoology, 10, 157-171. Lamb ... http://www.sles.und.ac.za/staff_academic.asp?RecordVAR=23 Academic staff: A., Raubenheimer, J. and Contrafatto, G. 1996, Variation of mitochondrial-DNA restriction fragment length in the species Otomys irroratus (Otomyinae: Muridae). ... http://www.veld.org.za/MCS%20Small%20Mammals.htm New Page 5: ...four rodent species captured comprised 2 Dendromus mystacalis (chestnut climbing mouse), 14 Mastomys coucha (multimammate mouse), 6 Otomys irroratus (vlei rat ... http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Retrieve&list_uids=1544328&dopt=Citation Genetic variation in the African rodent subfamily Otomyinae ...: II. Chromosomal changes in some populations of Otomys irroratus. Contrafatto G, Meester JA, Willan K, Taylor PJ, Roberts MA, Baker CM. ... http://www.nu.ac.za/sles/staff/staff.asp?id=51112 Staff Member: Variation of mitochondrial-DNA restriction length in the species Otomys irroratus (Otomyinae:Muridae). Mammalia, 60(4): 790 - 792 (1996). ... http://www.nu.ac.za/sles/papers/default.asp Recent Publications: 4: chromosome G- banding analysis of Otomys irroratus and O. angoniensis. ... 6: immuno-electro-transfer of liver proteins of some Otomys irroratus populations. ... http://apt.allenpress.com/aptonline/?request=get-abstract&issn=0022-2372&volume=081&issue=02&page=0317 PATTERNS OF CHROMOSOMAL VARIATION IN SOUTHERN AFRICAN RODENTS: ...similar peripatric or parapatric chromosome races freely interbreed (striped mice, Rhabdomys pumilio; vlei rats, Otomys irroratus), while genotypically or ... http://www.das-tierlexikon.de/lamellenzahnratten.htm Lamellenzahnratten: ...- [ Translate this page ] ... Die Afrikanische Lamellenzahn- oder Ohrenratte (Otomys irroratus) lebt im feuchten Grasland und in Sümpfen von Zimbabwe bis Südafrika. ... http://www.das-tierlexikon.de/inhalt_l.htm Lamellenzahn- oder Ohrenratten: ...- [ Translate this page ] ... Afrikanische Lamellenzahnratte. - Karru-Ratte. - Ohrenratte. - Otomys. - Otomys irroratus. - Parotomys. - Parotomys brantsi. - Landraubtiere. - Fissipedia. ... http://www.up.ac.za/academic/acadorgs/zssa/aardvark/no1_1997/undurb.html Department of Biology,: Current post-graduate students include Albert Kumari (Ph.D : Systematic revision of vlei rats of the Otomys irroratus - O. karoensis - O. tropicalis species ... http://www.up.ac.za/academic/entomological-society/rostrum/apr96/page3.html Rats, Bats, Dragons and Damsels: And for those wondering how our mammal counterparts fared - their traps filled with Otomys irroratus (vlei rat), Rhabdomys pumilio striped mice), Mus ... http://www.savci.upol.cz/hlod-4.htm Rodentia - Hlodavci: Vlei Rat Otomys angoniensis Wroughton, 1906 - myš - Angoni Vlei Rat Otomys denti Thomas, 1906 - myš bažinná - Dent's Vlei Rat Otomys irroratus (Brants, 1827 ... http://www.nasmus.co.za/MAMMALS/COLLECTI.HTM collection: Top. Nycteris thebaica. Orycteropus afer. Otocyon megalotis. Otomys irroratus. Otomys karoensis. Otomys sloggeti. Otomys unisulcatus. Top. Pedetes capensis. ... http://www.sntc.org.sz/checklst/mamamch.html Mammals Checklist - Malolotja Nature Reserve, Swaziland: ...murinus # Thryonomyidae Thryonomys swinderianus Cricetidae and Muridae Otomyinae Otomys laminatus # Otomys angoniensis Otomys irroratus Murinae Lemniscomys ... http://www.sntc.org.sz/checklst/sdmamchk.html Swaziland National Trust Commission - Swaziland's Fauna: Dendromus melanotis Dendromus mesomelas Dendromus mystacalis Steatomys pratensis Tatera leucogaster Otomys angoniensis Otomys irroratus, Common molerat Greater ... http://www.visitsouthafrica.com/National_Parks/Knysna_National_Lake_Area.asp VisitSouthAfrica.com - National Parks - Knysna National Lake Area: Chestnut climbing mouse, Dendromus mesomelas. Vlei rat, Otomys irroratus. Black rat, Rattus rattus. ... Vlei rat, Otomys irroratus. Rock dassie, Procavia capensis. ... http://www.visitsouthafrica.com/National_Parks/Bontebok_np2.asp VisitSouthAfrica.com - National Parks - Bontebok National Park: Dendromus melanotis (A.Smith, 1834), Grass Climbing Mouse. Otomys irroratus (Brants, 1827), Vlei Rat. Tatera afra (Gray, 1830), Cape Gerbil. ... http://www.nbi.ac.za/freestate/animals.htm NBI:Mammals in the Free State NBG: Striped mouse Rhabdomys pumilio Streepmuis, Wide range of habitats, Diurnal, Graminivorous. Vlei rat Otomys irroratus Vleirot, Near dams, ... http://www.knysna-info.co.za/english/content.asp?sectionid=241 South African National Parks: Striped mouse - Rhabdomys pumilio Pygmy mouse - Mus minutoides Chestnut climbing mouse - Dendromus mesomelas Vlei rat - Otomys irroratus Black rat - Rattus ... http://hybris.no.sapo.pt/documenta/mammal_boc.htm mammal_boc.html: ...- [ Translate this page ] ... TIPOS. Bocage, 1897b, p. 190. Só refere a bibliografia. Não havia tipos? França, 1908: Otomys irroratus Cuv. subesp. Anchietae Boc. ... http://www.monteco-nature-reserve.com/mammhead.htm MontEco Nature Reserve - Mammal List: Ystervark, N, S150, Brants' whistling rat, Parotomys brantsii, Brants se fluitrot, E, D, S156, Vlei rat, Otomys irroratus, Vleirot, D&N, S158, Karoo ... http://www.blackwell-synergy.com/links/doi/10.1046/j.1420-9101.2003.00651.x/enhancedabs/ Mate recognition in a freshwater fish: geographical distance ...: ..., Pillay, N., Willan, K. & Meester, J. 1995. Evidence of pre-mating reproductive isolation in two allopatric populations of the vlei rat (Otomys irroratus). ... http://www.culture-of-peace.info/muroid/table-36.html Muroid Rodents: Otomys irroratus, Davis, 1972, Approach Chase, Locked fighting Chase and bite rump, Lateral display, Offensive posture Boxing and pushing. ... http://www.culture-of-peace.info/muroid/references-39.html Motivational Systems in Muroid Rodents: Psychopharmacologia 9:210-219. Davis RM (1972): Behavior of vlei rat, Otomys irroratus (Brants, 1827). Zoologica Africana 7: 119-140. ... http://www.wetlands.org/RDB/Ramsar_Dir/SouthAfrica/ZA012D02.htm Ramsar Sites Database: ...albicauda, water mongoose Atilax paludinosus, hippopotamus Hippopotamus amphibius, reedbuck Redunca arundinum, Vlei otomys Otomys irroratus and African marsh ... http://home.sprynet.com/~awhit/lock2.htm Cafe Irreal #6: The Catalogue by Norman Lock: Next the esoteric: epimys nieventrisulae, graphiurus parvus, lophurmys aquilus, oenomys hypoxanthus bacchante, otomys irroratus tropicalis, paraxerus jacksoni ... http://146.230.130.48/conspec/Refs1.htm Refs1: J. Wildl. Res. 18:142-148. Bronner, GN, Gordon, SJG and Meester, J. Otomys irroratus. ... 2: chromosomal changes in some populations of Otomys irroratus. Cytogenet. ... http://146.230.130.48/conspec/oldpage.html conspec: Query The conspec Tissue Bank Otomys irroratus. This is a collection of frozen mammalian tissues (either in liquid nitrogen or. in a -80 ultra-deep-freezer). ... http://scilib.univ.kiev.ua/volume.php?54167 Сервер періодичних видань::Каталог ...: Z BOUTIBA,, 00613-00622. G CONTRAFATTO, PJ TAYLOR, K WILLAN, CLIMATIC CORRELATES OF CHROMOSOMAL VARIATION IN THE AFRICAN VLEI RAT, OTOMYS-IRRORATUS, 00623-00634. ... http://www.ecs.co.sz/bsap/chapter2.htm The Swaziland National Biodiversity Strategy and Action Plan: ...endemics) including the birds: Oenanthe bifasciata, Geocolaptes olivaceus and Macronyx capensis; the mammals: Pelea capreolus, Otomys irroratus and Amblysomus ... http://www.ecs.co.sz/malolotja_wardenscomments.htm Comments on the EIA/CMP for the proposed Greenstone Quarry: Rhinolophus clivosus), Grey pygmy climbing mouse (Dendromus melanotus), Brant's climbing mouse (Dendromus mesomelas), Vlei rat (Otomys irroratus)(Monadjem 1997 ... http://www.sun.ac.za/Research/Fakt-bos97.htm FAKULTEIT BOSBOU FACULTY OF FORESTRY: VAN WYK E, VAN HENSBERGEN HJ. The use of MGA for contraception in Rhabdomys pumilio and Otomys irroratus. Zoological Society of Southern Africa. ... http://www.mankwe-tours.com/about/species_list.htm Mankwe Eco-Awareness Tours - About Mankwe Tours: Species List: Red Veld Rat, Aethomys chiysophilus. Single-striped Rock Mouse, Lemniscomys rosalia. VIei Rat, Otomys irroratus. Scuindae, Tree Squirrel, Paraxerus cepapi. Pedetidae, ... http://www.zandvleitrust.org.za/mammal%20list.html Mammal List: 5. Rhabdomys pumilio, Stripped Field Mouse, C. 6. Mus minutoides, Pygmy Mouse, C. 7. Otomys irroratus, Vlei Rat, VC. 8. Aonyx capensis, Cape Clawless Otter, UC. ... http://falcon.tamucc.edu/~ghickman/Research.htm Research: WILLAN, KENNETH AND GC HICKMAN. 1986. Niche separation in Otomys irroratus, Rhabdomys pumilio and Praomys natalensis: responses to food deprivation. ... http://www.saparks.com/SouthAfrica/wilderness/wilderness_main.htm Wilderness National Park - South Africa: Dendromus mesomelas. Vlei rat. Otomys irroratus. Black rat. Rattus rattus. Cape fur seal. ... Dendromus mesomelas. Vlei rat. Otomys irroratus. Rock dassie. Procavia capensis. ... http://www.saparks.com/SouthAfrica/GoldenGate/goldengate_main.htm Golden Gate National park - South Africa: Mystromus albicaudatu. WHITE-TAILED RAT (VULNERABLE). Tatera brantsi. HIGHVELD GERBIL. Otomys irroratus. VLEI RAT. Otomys sloggetti. ROCK KAROO RAT. FAMILY MURIDAE. ... http://www.crackmack.de/rattenarten.html Crackmack´s Rattenpage: ...- [ Translate this page ] ... Nach einer Tragezeit von 29-30 Tagen werden 2 bis 3 Würfe von jeweils 3 bis 4 Jungen geboren. Lamellen- zahnratte/Ohrenratte Otomys Irroratus ... http://www.garfield.library.upenn.edu/histcomp/ayala-fj_w-citing/index-lcs-20.html HistCite - index: 330 papers and books by FJ Ayala <br> (including ...: ROBERTS MA; BAKER CM GENETIC-VARIATION IN THE AFRICAN RODENT SUBFAMILY OTOMYINAE (MURIDAE) .2. CHROMOSOMAL CHANGES IN SOME POPULATIONS OF OTOMYS-IRRORATUS, 0, 9. ... http://www.bioone.org/bioone/?request=get-document&issn=0022-2372&volume=084&issue=02&page=0505 REPRODUCTIVE BIOLOGY OF A RARE AFRICAN RODENT, THE WATER RAT ...: 2001 ), and the more distantly related, but ecologically similar, vlei rat, Otomys irroratus (Skinner and Smithers 1990 ); D. incomtus and A. chrysophilus ... http://www.bioone.org/bioone/?request=get-document&issn=0022-2372&volume=083&issue=01&page=0290 DELAYED RESPONSES OF SMALL-MAMMAL ASSEMBLAGES SUBJECT TO ...: Mus minutoides (n = 27), climbing mouse Dendromus mysticalis (n = 21), rock rats A. chrysophilus and A. namaquensis (n = 20), vlei rat Otomys irroratus (n = 15 ... http://members.vienna.at/shrew/shrewtalk=1-08.html Shrew Talk: ...type and species relative abundances were: valleys and north slopes with Rhabdomys pumilio; south slopes with Myosorex varius and Otomys irroratus; east slopes ... http://zoo.upe.ac.za/grysbok/tmammal.htm Grysbok Trail - Mammals: Vlei Rat Otomys irroratus, A "vlei" is an area of shallow, temporary standing water, thus Vlei Rats are associated with wet areas and stream verge habitats ... http://www.rodent.be/rodentnederlands/Taxonomie/muridae.htm Muridae: Nesomys rufus. Subfamilie Otomyinae. Otomys. Otomys anchietae. Otomys angoniensis. Otomys denti. Otomys irroratus. Otomys laminatus. Otomys maximus. Otomys saundersiae. ... http://www.rodent.be/rodentfrans/Taxonomie/muridae.htm Muridae: Genre Otomyinae. Otomys. Otomys anchietae. Otomys angoniensis. Otomys denti. Otomys irroratus. Otomys laminatus. Otomys maximus. Otomys saundersiae. Otomys sloggetti. ... http://www.inasp.info/ajol/journals/sajwr/vol32no2abs.html AJOL: South African Journal of Wildlife Research: Volume 32, Issue ...: ...pumilio was present in all the habitat types sampled and that species such as Crocidura mariquensis, Myosorex varius and Otomys irroratus were closely ... http://www.environment.gov.za/enviro-info/sote/nsoer/resource/wetland/sibaya_ris.htm Lake Sibaya Ramsar Information Sheet: ...water mongoose (Atilax paludinosus), hippopotamus (Hippopotamus amphibius), reedbuck (Redunca arundinum), Vlei otomys (Otomys irroratus) and African marsh rat ... http://www.environment.gov.za/enviro-info/sote/nsoer/resource/wetland/wilderness_ris.htm Wilderness Lakes Ramsar Information Sheet: Limited surveys of small mammals showed that there are vlei rats Otomys irroratus, striped mice Rhabdomys pumilio, red musk shrews Crocidura flavescens and ... http://perso.club-internet.fr/boudetjo/ZooList/Mammif/ClasRode.html Classification des Rodentiens: OTOMYINAE, Otomys Parotomys, Otomys anchietae Otomys angoniensis Otomys denti Otomys irroratus Otomys laminatus Otomys maximus Otomys occidentalis Otomys ... http://nema.cap.ed.ac.uk/nematodeESTs/Trichinella/Trichinella_B1/Tstable300-349/Tsmc_335nnr.html BLASTN 2.1.1 [Aug-8-2000] Reference: 68 5e-09 gb|AF141255.1|AF141255 Parotomys brantsii 16S ribosomal RNA... 68 5e-09 gb|AF141253.1|AF141253 Otomys irroratus country South Afric... ... http://nema.cap.ed.ac.uk/nematodeESTs/Trichinella/Trichinella_B1/Tstable300-349/Tsmc_338nnr.html BLASTN 2.1.1 [Aug-8-2000] Reference: 42 0.21 gb|AF141255.1|AF141255 Parotomys brantsii 16S ribosomal RNA... 42 0.21 gb|AF141253.1|AF141253 Otomys irroratus country South Afric... ... http://web.uct.ac.za/depts/fitzpatrick/docs/r566.html Cape Bulbul: 35% of nests) and predation that accounted for 83% of nest losses; mammals (particularly rodents such as Bush Otomys Otomys irroratus, Forest Dormouse ... http://web.uct.ac.za/depts/fitzpatrick/docs/r165.html African Marsh-Harrier: In most instances birds are hunting for small mammals especially Striped Mice Rhabdomys pumilio and Vlei Rats Otomys irroratus (74 % frequency: Kemp & Dean 1988 ... http://animaldiversity.ummz.umich.edu/site/accounts/classification/Otomyinae.html ADW: Otomyinae: Classification: ...rat). Species Otomys denti (Dent's vlei rat). Species Otomys irroratus (vlei rat). Species Otomys laminatus (laminate vlei rat). Species ... http://bison.zbs.bialowieza.pl/acta/contents/vol40no1.html ACTA THERIOLOGICA Vol. 40, No. 1, March 1995: Post-zygotic reproductive isolation in two populations of the African vlei rat Otomys irroratus Pillay N., Willan K. and Meester J. page 69-76. ... http://biblio68.ibiologia.unam.mx/FullText/c19.html Cuaderno No. 19: ...- [ Translate this page ] ... Bukavu, Congo Belga. Sobre Otomys irroratus. Sin fecha. PG Vercammen-Grandjean leg. ... Mushweshwe, Congo Belga. Sobre Otomys irroratus. Sin fecha. Lorge leg. ... http://www.press.jhu.edu/books/walkers_mammals_of_the_world/refs/walker.ref-d.html Literature Cited, D: Internatl. Whaling Comm. 28:209-15. Davis, RM 1972. Behaviour of the vlei rat, Otomys irroratus (Brants, 1827). Zool. Afr. 7:119-40. Davis, RM, and J. Meester. ... http://www.und.ac.za/und/cogen/asmn/asmn2.html ASMN- page 2: Emmanuel will be investigating east-west variation in Rhabdomys pumilio and Kwame will be looking at the differences between two populations of Otomys irroratus ... http://www.und.ac.za/und/cogen/ak.html ALBERT KUMIRAI: ...by Peter Taylor and Glen Campbell involves morphometric and chromosomal aspects of Otomyines evolution with a focus on the species Otomys irroratus and O ... http://genoma.unsam.edu.ar/projects/tupaia/blast_dir/nr/tu.fasta.screen.Contig226.br BLASTX 2.1.3 [Apr-1-2001] Reference: Altschul, Stephen F., Thomas ...: Sbjct: 181 FHFILPFIITALVIVHLLFLHETGSSNPLGIDSDADKIPFHPYYTIKDI 229 >gi|7648613|gb|AAF65611.1| (AF141222) cytochrome b [Otomys irroratus] Length = 380 Score = 389 ... http://www.zmuc.dk/commonweb/research/biodata_sources_mammals.htm Sources for compilation of Africa databases: mammals: 1992. Genetic variation in the African rodent sub-family Otomyinae (Muridae). IV: Chromosome G-banding analysis of Otomys irroratus and O. angoniensis. ... http://www.ici.com/icishe/naturelink/sightings/sighting5821.htm ICI - Nature Link Database: Sighting details for Vlei Rat. Go Back To Previous Screen. Site: MANKWE. Species: Vlei Rat Otomys irroratus. Species: Vlei Rat. Genus: Otomys. Family: Muridae. ... http://www.ici.com/icishe/naturelink/indexsp2O.htm ICI - Nature Link Database: Orycteropus afer, Oryctolagus cuniculus, Oryx beisa callotis. Oryx gazella *, Oryzomys flavescens, Otomys irroratus. Otpcyon megalotis, Otus asio, Otus leucotis. ... http://www.eeb.uconn.edu/Courses/EEB449/449_allopatric.htm Geographical/Allopatric Speciation (October 2002): 1995. Evidence of pre-mating reproductive isolation in two allopatric populations of the Vlei rat, Otomys irroratus. Ethology 100(1): 61-71. Powell, JR 1978. ... http://www.eeb.uconn.edu/Courses/EEB449/449_sexselec_specia.htm Aguin-Pombo, D: 1995. Evidence of pre-mating reproductive isolation in two allopatric populations of the Vlei rat, Otomys irroratus. Ethology 100(1): 61-71. ... http://www.wits.ac.za/alumni/news9b.shtml Office of Alumni Affairs: University. Monday 16 October: 4. Interpopulation variation in the copulatory behaviour of the vlei rat otomys irroratus. Speaker ... http://www.wits.ac.za/alumni/news10.shtml Newsletter # 10 - OCTOBER 1995: Venue: Room B14, Biology Building. (1). Interpopulation variation in the copulatory behaviour of the vlei rat otomys irroratus. ... http://rathole.com/litter/rat/ RATHOLE.COM - Rat of the Week - Swamp Rat - - - -: Swamp Rat Otomys irroratus. RANGE: Zimbabwe to South Africa. HABITAT: damp grasslands, swamps. SIZE: body: 5-7.75 in; tail: 2-6.75 in. ... http://bch-cbd.naturalsciences.be/congodr/cdr-fra/contribution/strataction/etat/annexes/tab7.htm Mammifères des parcs nationaux du Congo: ...- [ Translate this page ] ... Mus triton Mus sorella Mus bufo Mylomys dybowskii Oenomys hypoxanthus Otomys irroratus Otomys typus Paraxerus boehmi Paraxerus alexandri Pelomys fallax ... http://www.cse.ucsc.edu/research/compbio/yeast-protein-predictions/Q010/Q0105/Q0105.t2k.pa.html a2m2html output for file tmp.a2m: ...aegagrus]. gi|3241888|dbj|BAA28889.1|_2:377 cytochrome b [Sus scrofa]. gi|7648613|gb|AAF65611.1|_2:378 cytochrome b [Otomys irroratus]. gi ... http://protea.worldonline.co.za/picking.htm Protea Picking: Occasionally, picking may even not be by human agents, as in the case of predation by Otomys irroratus (as may have been the case in the record for Serruria ... http://www.parksnorthwest.co.za/pilanesberg/pilanesberg_animals.html Animal Checklist: Pilanesberg National Park in the North West ...: Otomys angoniensis, English Setswana Afrikaans, Angoni vlei rat Nthufe Angoni-vleirot. Otomys irroratus, English Setswana Afrikaans, Angoni vlei rat Peba Vleirot. ... http://mossie.cs.und.ac.za/~murrellh/conservancy/mammals.html msinsi mammals: Epomophorus sp. Wahlberg's epauletted fruit bat. Otomys irroratus, Vleirat. Common Visitors. Cercopithecus aethiops, Vervet monkey. Mungos mungo, Banded mongoose. ... http://www.esapubs.org/archive/ecol/E084/094/MOMv3.3.txt AF extant Artiodactyla Bovidae Addax nasomaculatus 4.85 70000.3 60 ...: ...- [ Translate this page ] ... Rodentia Muridae Otomys unisulcatus 2.1 124.5 60 AF extant Rodentia Muridae Otomys denti 2.08 120 135 AF extant Rodentia Muridae Otomys irroratus 2.01 101.8 ... http://www.mujweb.cz/Veda/traxler/rongul.htm ordo : RONĜULOJ - Rodentia - hlodavci: ...genro : otomuso - Otomys. specio : otomuso lameldenta - Otomys irroratus - myš lamelozubá. subfamilio : muzelmusenoj - Rhynchomyinae - nosaté myši. ... http://www.pubmedcentral.nih.gov/articlerender.fcgi?artid=59666 Isozyme and allozyme markers distinguishing two morphologically ...: Johnson and Selander [12] obtained 7.9% in the Heteromyid Dipdomys, 17.4% for Otomys irroratus[13], 16.1% for Rhabdomys pumilio[14], and 6.7% for Oryzomys ... http://www.bionet.nsc.ru/chromosomes/rodentia/references.htm Elobius talpinus Pallas: Genetic variation in the African rodent subfamily Otomyinae (Muridae). II. Chromosomal changes in some populations of Otomys irroratus. Cytogenet. ... http://www.phthiraptera.org/Mammals/Muridae.html Mammals: Muridae: Otomys denti Thomas, 1906 - Dent´s Vlei Rat Polyplax otomydis Cummings, 1912. Otomys irroratus (Brants, 1827) - Vlei Rat Polyplax otomydis Cummings, 1912. ... http://www.science.smith.edu/departments/Biology/VHAYSSEN/msi/msibiblio.html [an error occurred while processing this directive] Otomys irroratus [an error occurred while processing this directive] 15654 Vlei Rat Vlei Rat The Common Vlei Rat - Otomys irroratus of Southern Africa: A Guide to the: Common Vlei Rat - Otomys irroratus. The Common Vlei Rat is a blunt nosed rat with long, shaggy hair and rather a short tail. ... http://www.ru.ac.za/academic/departments/zooento/Martin/hystrichopsyllidae.html Checklist: South African Hystricopsyllid Fleas (Siphonaptera ...: KwaZulu-Natal, Mpumalanga, Northern Province and Northwestern Province, to Zimbabwe; hosted by Otomys irroratus , O. tugelensis , Rhabdomys pumilio , Praomys ... http://www.ru.ac.za/academic/departments/zooento/Martin/chimaeropsyllidae.html Checklist: South African Chimaeropsyllid Fleas (Siphonaptera ...: Mpumalanga, Gauteng, Northwestern Province and Northern Cape, to Zimbabwe; hosted by Tatera brantsii , Rhabdomys pumilio , Otomys irroratus , O. unisulcatus ... http://content.karger.com/ProdukteDB/produkte.asp?Doi=56993 Karger Publishers: Chromosomal evolution in the vlei rat, Otomys irroratus (Muridae: Otomyinae): a compound chromosomal rearrangement separates two major cytogenetic groups RV ... http://content.karger.com/ProdukteDB/produkte.asp?Aktion=Ausgabe&ProduktNr=224037&Ausgabe=228256&searchWhat=books Karger Publishers: 253, Chromosomal evolution in the vlei rat, Otomys irroratus (Muridae: Otomyinae): a compound chromosomal rearrangement separates two major cytogenetic groups ... http://www.sles.und.ac.za/staff_academic.asp?RecordVAR=22 Academic staff: Otomyinae (Muridae). 6: immuno-electro-transfer of liver proteins of some Otomys irroratus populations. Tropical Zoology, 10, 157-171. Lamb ... http://www.sles.und.ac.za/staff_academic.asp?RecordVAR=23 Academic staff: A., Raubenheimer, J. and Contrafatto, G. 1996, Variation of mitochondrial-DNA restriction fragment length in the species Otomys irroratus (Otomyinae: Muridae). ... http://www.veld.org.za/MCS%20Small%20Mammals.htm New Page 5: ...four rodent species captured comprised 2 Dendromus mystacalis (chestnut climbing mouse), 14 Mastomys coucha (multimammate mouse), 6 Otomys irroratus (vlei rat ... http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Retrieve&list_uids=1544328&dopt=Citation Genetic variation in the African rodent subfamily Otomyinae ...: II. Chromosomal changes in some populations of Otomys irroratus. Contrafatto G, Meester JA, Willan K, Taylor PJ, Roberts MA, Baker CM. ... http://www.nu.ac.za/sles/staff/staff.asp?id=51112 Staff Member: Variation of mitochondrial-DNA restriction length in the species Otomys irroratus (Otomyinae:Muridae). Mammalia, 60(4): 790 - 792 (1996). ... http://www.nu.ac.za/sles/papers/default.asp Recent Publications: 4: chromosome G- banding analysis of Otomys irroratus and O. angoniensis. ... 6: immuno-electro-transfer of liver proteins of some Otomys irroratus populations. ... http://apt.allenpress.com/aptonline/?request=get-abstract&issn=0022-2372&volume=081&issue=02&page=0317 PATTERNS OF CHROMOSOMAL VARIATION IN SOUTHERN AFRICAN RODENTS: ...similar peripatric or parapatric chromosome races freely interbreed (striped mice, Rhabdomys pumilio; vlei rats, Otomys irroratus), while genotypically or ... http://www.das-tierlexikon.de/lamellenzahnratten.htm Lamellenzahnratten: ...- [ Translate this page ] ... Die Afrikanische Lamellenzahn- oder Ohrenratte (Otomys irroratus) lebt im feuchten Grasland und in Sümpfen von Zimbabwe bis Südafrika. ... http://www.das-tierlexikon.de/inhalt_l.htm Lamellenzahn- oder Ohrenratten: ...- [ Translate this page ] ... Afrikanische Lamellenzahnratte. - Karru-Ratte. - Ohrenratte. - Otomys. - Otomys irroratus. - Parotomys. - Parotomys brantsi. - Landraubtiere. - Fissipedia. ... http://www.up.ac.za/academic/acadorgs/zssa/aardvark/no1_1997/undurb.html Department of Biology,: Current post-graduate students include Albert Kumari (Ph.D : Systematic revision of vlei rats of the Otomys irroratus - O. karoensis - O. tropicalis species ... http://www.up.ac.za/academic/entomological-society/rostrum/apr96/page3.html Rats, Bats, Dragons and Damsels: And for those wondering how our mammal counterparts fared - their traps filled with Otomys irroratus (vlei rat), Rhabdomys pumilio striped mice), Mus ... http://www.savci.upol.cz/hlod-4.htm Rodentia - Hlodavci: Vlei Rat Otomys angoniensis Wroughton, 1906 - myš - Angoni Vlei Rat Otomys denti Thomas, 1906 - myš bažinná - Dent's Vlei Rat Otomys irroratus (Brants, 1827 ... http://www.nasmus.co.za/MAMMALS/COLLECTI.HTM collection: Top. Nycteris thebaica. Orycteropus afer. Otocyon megalotis. Otomys irroratus. Otomys karoensis. Otomys sloggeti. Otomys unisulcatus. Top. Pedetes capensis. ... http://www.sntc.org.sz/checklst/mamamch.html Mammals Checklist - Malolotja Nature Reserve, Swaziland: ...murinus # Thryonomyidae Thryonomys swinderianus Cricetidae and Muridae Otomyinae Otomys laminatus # Otomys angoniensis Otomys irroratus Murinae Lemniscomys ... http://www.sntc.org.sz/checklst/sdmamchk.html Swaziland National Trust Commission - Swaziland's Fauna: Dendromus melanotis Dendromus mesomelas Dendromus mystacalis Steatomys pratensis Tatera leucogaster Otomys angoniensis Otomys irroratus, Common molerat Greater ... http://www.visitsouthafrica.com/National_Parks/Knysna_National_Lake_Area.asp VisitSouthAfrica.com - National Parks - Knysna National Lake Area: Chestnut climbing mouse, Dendromus mesomelas. Vlei rat, Otomys irroratus. Black rat, Rattus rattus. ... Vlei rat, Otomys irroratus. Rock dassie, Procavia capensis. ... http://www.visitsouthafrica.com/National_Parks/Bontebok_np2.asp VisitSouthAfrica.com - National Parks - Bontebok National Park: Dendromus melanotis (A.Smith, 1834), Grass Climbing Mouse. Otomys irroratus (Brants, 1827), Vlei Rat. Tatera afra (Gray, 1830), Cape Gerbil. ... http://www.nbi.ac.za/freestate/animals.htm NBI:Mammals in the Free State NBG: Striped mouse Rhabdomys pumilio Streepmuis, Wide range of habitats, Diurnal, Graminivorous. Vlei rat Otomys irroratus Vleirot, Near dams, ... http://www.knysna-info.co.za/english/content.asp?sectionid=241 South African National Parks: Striped mouse - Rhabdomys pumilio Pygmy mouse - Mus minutoides Chestnut climbing mouse - Dendromus mesomelas Vlei rat - Otomys irroratus Black rat - Rattus ... http://hybris.no.sapo.pt/documenta/mammal_boc.htm mammal_boc.html: ...- [ Translate this page ] ... TIPOS. Bocage, 1897b, p. 190. Só refere a bibliografia. Não havia tipos? França, 1908: Otomys irroratus Cuv. subesp. Anchietae Boc. ... http://www.monteco-nature-reserve.com/mammhead.htm MontEco Nature Reserve - Mammal List: Ystervark, N, S150, Brants' whistling rat, Parotomys brantsii, Brants se fluitrot, E, D, S156, Vlei rat, Otomys irroratus, Vleirot, D&N, S158, Karoo ... http://www.blackwell-synergy.com/links/doi/10.1046/j.1420-9101.2003.00651.x/enhancedabs/ Mate recognition in a freshwater fish: geographical distance ...: ..., Pillay, N., Willan, K. & Meester, J. 1995. Evidence of pre-mating reproductive isolation in two allopatric populations of the vlei rat (Otomys irroratus). ... http://www.culture-of-peace.info/muroid/table-36.html Muroid Rodents: Otomys irroratus, Davis, 1972, Approach Chase, Locked fighting Chase and bite rump, Lateral display, Offensive posture Boxing and pushing. ... http://www.culture-of-peace.info/muroid/references-39.html Motivational Systems in Muroid Rodents: Psychopharmacologia 9:210-219. Davis RM (1972): Behavior of vlei rat, Otomys irroratus (Brants, 1827). Zoologica Africana 7: 119-140. ... http://www.wetlands.org/RDB/Ramsar_Dir/SouthAfrica/ZA012D02.htm Ramsar Sites Database: ...albicauda, water mongoose Atilax paludinosus, hippopotamus Hippopotamus amphibius, reedbuck Redunca arundinum, Vlei otomys Otomys irroratus and African marsh ... http://home.sprynet.com/~awhit/lock2.htm Cafe Irreal #6: The Catalogue by Norman Lock: Next the esoteric: epimys nieventrisulae, graphiurus parvus, lophurmys aquilus, oenomys hypoxanthus bacchante, otomys irroratus tropicalis, paraxerus jacksoni ... http://146.230.130.48/conspec/Refs1.htm Refs1: J. Wildl. Res. 18:142-148. Bronner, GN, Gordon, SJG and Meester, J. Otomys irroratus. ... 2: chromosomal changes in some populations of Otomys irroratus. Cytogenet. ... http://146.230.130.48/conspec/oldpage.html conspec: Query The conspec Tissue Bank Otomys irroratus. This is a collection of frozen mammalian tissues (either in liquid nitrogen or. in a -80 ultra-deep-freezer). ... http://scilib.univ.kiev.ua/volume.php?54167 Сервер періодичних видань::Каталог ...: Z BOUTIBA,, 00613-00622. G CONTRAFATTO, PJ TAYLOR, K WILLAN, CLIMATIC CORRELATES OF CHROMOSOMAL VARIATION IN THE AFRICAN VLEI RAT, OTOMYS-IRRORATUS, 00623-00634. ... http://www.ecs.co.sz/bsap/chapter2.htm The Swaziland National Biodiversity Strategy and Action Plan: ...endemics) including the birds: Oenanthe bifasciata, Geocolaptes olivaceus and Macronyx capensis; the mammals: Pelea capreolus, Otomys irroratus and Amblysomus ... http://www.ecs.co.sz/malolotja_wardenscomments.htm Comments on the EIA/CMP for the proposed Greenstone Quarry: Rhinolophus clivosus), Grey pygmy climbing mouse (Dendromus melanotus), Brant's climbing mouse (Dendromus mesomelas), Vlei rat (Otomys irroratus)(Monadjem 1997 ... http://www.sun.ac.za/Research/Fakt-bos97.htm FAKULTEIT BOSBOU FACULTY OF FORESTRY: VAN WYK E, VAN HENSBERGEN HJ. The use of MGA for contraception in Rhabdomys pumilio and Otomys irroratus. Zoological Society of Southern Africa. ... http://www.mankwe-tours.com/about/species_list.htm Mankwe Eco-Awareness Tours - About Mankwe Tours: Species List: Red Veld Rat, Aethomys chiysophilus. Single-striped Rock Mouse, Lemniscomys rosalia. VIei Rat, Otomys irroratus. Scuindae, Tree Squirrel, Paraxerus cepapi. Pedetidae, ... http://www.zandvleitrust.org.za/mammal%20list.html Mammal List: 5. Rhabdomys pumilio, Stripped Field Mouse, C. 6. Mus minutoides, Pygmy Mouse, C. 7. Otomys irroratus, Vlei Rat, VC. 8. Aonyx capensis, Cape Clawless Otter, UC. ... http://falcon.tamucc.edu/~ghickman/Research.htm Research: WILLAN, KENNETH AND GC HICKMAN. 1986. Niche separation in Otomys irroratus, Rhabdomys pumilio and Praomys natalensis: responses to food deprivation. ... http://www.saparks.com/SouthAfrica/wilderness/wilderness_main.htm Wilderness National Park - South Africa: Dendromus mesomelas. Vlei rat. Otomys irroratus. Black rat. Rattus rattus. Cape fur seal. ... Dendromus mesomelas. Vlei rat. Otomys irroratus. Rock dassie. Procavia capensis. ... http://www.saparks.com/SouthAfrica/GoldenGate/goldengate_main.htm Golden Gate National park - South Africa: Mystromus albicaudatu. WHITE-TAILED RAT (VULNERABLE). Tatera brantsi. HIGHVELD GERBIL. Otomys irroratus. VLEI RAT. Otomys sloggetti. ROCK KAROO RAT. FAMILY MURIDAE. ... http://www.crackmack.de/rattenarten.html Crackmack´s Rattenpage: ...- [ Translate this page ] ... Nach einer Tragezeit von 29-30 Tagen werden 2 bis 3 Würfe von jeweils 3 bis 4 Jungen geboren. Lamellen- zahnratte/Ohrenratte Otomys Irroratus ... http://www.garfield.library.upenn.edu/histcomp/ayala-fj_w-citing/index-lcs-20.html HistCite - index: 330 papers and books by FJ Ayala <br> (including ...: ROBERTS MA; BAKER CM GENETIC-VARIATION IN THE AFRICAN RODENT SUBFAMILY OTOMYINAE (MURIDAE) .2. CHROMOSOMAL CHANGES IN SOME POPULATIONS OF OTOMYS-IRRORATUS, 0, 9. ... http://www.bioone.org/bioone/?request=get-document&issn=0022-2372&volume=084&issue=02&page=0505 REPRODUCTIVE BIOLOGY OF A RARE AFRICAN RODENT, THE WATER RAT ...: 2001 ), and the more distantly related, but ecologically similar, vlei rat, Otomys irroratus (Skinner and Smithers 1990 ); D. incomtus and A. chrysophilus ... http://www.bioone.org/bioone/?request=get-document&issn=0022-2372&volume=083&issue=01&page=0290 DELAYED RESPONSES OF SMALL-MAMMAL ASSEMBLAGES SUBJECT TO ...: Mus minutoides (n = 27), climbing mouse Dendromus mysticalis (n = 21), rock rats A. chrysophilus and A. namaquensis (n = 20), vlei rat Otomys irroratus (n = 15 ... http://members.vienna.at/shrew/shrewtalk=1-08.html Shrew Talk: ...type and species relative abundances were: valleys and north slopes with Rhabdomys pumilio; south slopes with Myosorex varius and Otomys irroratus; east slopes ... http://zoo.upe.ac.za/grysbok/tmammal.htm Grysbok Trail - Mammals: Vlei Rat Otomys irroratus, A "vlei" is an area of shallow, temporary standing water, thus Vlei Rats are associated with wet areas and stream verge habitats ... http://www.rodent.be/rodentnederlands/Taxonomie/muridae.htm Muridae: Nesomys rufus. Subfamilie Otomyinae. Otomys. Otomys anchietae. Otomys angoniensis. Otomys denti. Otomys irroratus. Otomys laminatus. Otomys maximus. Otomys saundersiae. ... http://www.rodent.be/rodentfrans/Taxonomie/muridae.htm Muridae: Genre Otomyinae. Otomys. Otomys anchietae. Otomys angoniensis. Otomys denti. Otomys irroratus. Otomys laminatus. Otomys maximus. Otomys saundersiae. Otomys sloggetti. ... http://www.inasp.info/ajol/journals/sajwr/vol32no2abs.html AJOL: South African Journal of Wildlife Research: Volume 32, Issue ...: ...pumilio was present in all the habitat types sampled and that species such as Crocidura mariquensis, Myosorex varius and Otomys irroratus were closely ... http://www.environment.gov.za/enviro-info/sote/nsoer/resource/wetland/sibaya_ris.htm Lake Sibaya Ramsar Information Sheet: ...water mongoose (Atilax paludinosus), hippopotamus (Hippopotamus amphibius), reedbuck (Redunca arundinum), Vlei otomys (Otomys irroratus) and African marsh rat ... http://www.environment.gov.za/enviro-info/sote/nsoer/resource/wetland/wilderness_ris.htm Wilderness Lakes Ramsar Information Sheet: Limited surveys of small mammals showed that there are vlei rats Otomys irroratus, striped mice Rhabdomys pumilio, red musk shrews Crocidura flavescens and ... http://perso.club-internet.fr/boudetjo/ZooList/Mammif/ClasRode.html Classification des Rodentiens: OTOMYINAE, Otomys Parotomys, Otomys anchietae Otomys angoniensis Otomys denti Otomys irroratus Otomys laminatus Otomys maximus Otomys occidentalis Otomys ... http://nema.cap.ed.ac.uk/nematodeESTs/Trichinella/Trichinella_B1/Tstable300-349/Tsmc_335nnr.html BLASTN 2.1.1 [Aug-8-2000] Reference: 68 5e-09 gb|AF141255.1|AF141255 Parotomys brantsii 16S ribosomal RNA... 68 5e-09 gb|AF141253.1|AF141253 Otomys irroratus country South Afric... ... http://nema.cap.ed.ac.uk/nematodeESTs/Trichinella/Trichinella_B1/Tstable300-349/Tsmc_338nnr.html BLASTN 2.1.1 [Aug-8-2000] Reference: 42 0.21 gb|AF141255.1|AF141255 Parotomys brantsii 16S ribosomal RNA... 42 0.21 gb|AF141253.1|AF141253 Otomys irroratus country South Afric... ... http://web.uct.ac.za/depts/fitzpatrick/docs/r566.html Cape Bulbul: 35% of nests) and predation that accounted for 83% of nest losses; mammals (particularly rodents such as Bush Otomys Otomys irroratus, Forest Dormouse ... http://web.uct.ac.za/depts/fitzpatrick/docs/r165.html African Marsh-Harrier: In most instances birds are hunting for small mammals especially Striped Mice Rhabdomys pumilio and Vlei Rats Otomys irroratus (74 % frequency: Kemp & Dean 1988 ... http://animaldiversity.ummz.umich.edu/site/accounts/classification/Otomyinae.html ADW: Otomyinae: Classification: ...rat). Species Otomys denti (Dent's vlei rat). Species Otomys irroratus (vlei rat). Species Otomys laminatus (laminate vlei rat). Species ... http://bison.zbs.bialowieza.pl/acta/contents/vol40no1.html ACTA THERIOLOGICA Vol. 40, No. 1, March 1995: Post-zygotic reproductive isolation in two populations of the African vlei rat Otomys irroratus Pillay N., Willan K. and Meester J. page 69-76. ... http://biblio68.ibiologia.unam.mx/FullText/c19.html Cuaderno No. 19: ...- [ Translate this page ] ... Bukavu, Congo Belga. Sobre Otomys irroratus. Sin fecha. PG Vercammen-Grandjean leg. ... Mushweshwe, Congo Belga. Sobre Otomys irroratus. Sin fecha. Lorge leg. ... http://www.press.jhu.edu/books/walkers_mammals_of_the_world/refs/walker.ref-d.html Literature Cited, D: Internatl. Whaling Comm. 28:209-15. Davis, RM 1972. Behaviour of the vlei rat, Otomys irroratus (Brants, 1827). Zool. Afr. 7:119-40. Davis, RM, and J. Meester. ... http://www.und.ac.za/und/cogen/asmn/asmn2.html ASMN- page 2: Emmanuel will be investigating east-west variation in Rhabdomys pumilio and Kwame will be looking at the differences between two populations of Otomys irroratus ... http://www.und.ac.za/und/cogen/ak.html ALBERT KUMIRAI: ...by Peter Taylor and Glen Campbell involves morphometric and chromosomal aspects of Otomyines evolution with a focus on the species Otomys irroratus and O ... http://genoma.unsam.edu.ar/projects/tupaia/blast_dir/nr/tu.fasta.screen.Contig226.br BLASTX 2.1.3 [Apr-1-2001] Reference: Altschul, Stephen F., Thomas ...: Sbjct: 181 FHFILPFIITALVIVHLLFLHETGSSNPLGIDSDADKIPFHPYYTIKDI 229 >gi|7648613|gb|AAF65611.1| (AF141222) cytochrome b [Otomys irroratus] Length = 380 Score = 389 ... http://www.zmuc.dk/commonweb/research/biodata_sources_mammals.htm Sources for compilation of Africa databases: mammals: 1992. Genetic variation in the African rodent sub-family Otomyinae (Muridae). IV: Chromosome G-banding analysis of Otomys irroratus and O. angoniensis. ... http://www.ici.com/icishe/naturelink/sightings/sighting5821.htm ICI - Nature Link Database: Sighting details for Vlei Rat. Go Back To Previous Screen. Site: MANKWE. Species: Vlei Rat Otomys irroratus. Species: Vlei Rat. Genus: Otomys. Family: Muridae. ... http://www.ici.com/icishe/naturelink/indexsp2O.htm ICI - Nature Link Database: Orycteropus afer, Oryctolagus cuniculus, Oryx beisa callotis. Oryx gazella *, Oryzomys flavescens, Otomys irroratus. Otpcyon megalotis, Otus asio, Otus leucotis. ... http://www.eeb.uconn.edu/Courses/EEB449/449_allopatric.htm Geographical/Allopatric Speciation (October 2002): 1995. Evidence of pre-mating reproductive isolation in two allopatric populations of the Vlei rat, Otomys irroratus. Ethology 100(1): 61-71. Powell, JR 1978. ... http://www.eeb.uconn.edu/Courses/EEB449/449_sexselec_specia.htm Aguin-Pombo, D: 1995. Evidence of pre-mating reproductive isolation in two allopatric populations of the Vlei rat, Otomys irroratus. Ethology 100(1): 61-71. ... http://www.wits.ac.za/alumni/news9b.shtml Office of Alumni Affairs: University. Monday 16 October: 4. Interpopulation variation in the copulatory behaviour of the vlei rat otomys irroratus. Speaker ... http://www.wits.ac.za/alumni/news10.shtml Newsletter # 10 - OCTOBER 1995: Venue: Room B14, Biology Building. (1). Interpopulation variation in the copulatory behaviour of the vlei rat otomys irroratus. ... http://rathole.com/litter/rat/ RATHOLE.COM - Rat of the Week - Swamp Rat - - - -: Swamp Rat Otomys irroratus. RANGE: Zimbabwe to South Africa. HABITAT: damp grasslands, swamps. SIZE: body: 5-7.75 in; tail: 2-6.75 in. ... http://bch-cbd.naturalsciences.be/congodr/cdr-fra/contribution/strataction/etat/annexes/tab7.htm Mammifères des parcs nationaux du Congo: ...- [ Translate this page ] ... Mus triton Mus sorella Mus bufo Mylomys dybowskii Oenomys hypoxanthus Otomys irroratus Otomys typus Paraxerus boehmi Paraxerus alexandri Pelomys fallax ... http://www.cse.ucsc.edu/research/compbio/yeast-protein-predictions/Q010/Q0105/Q0105.t2k.pa.html a2m2html output for file tmp.a2m: ...aegagrus]. gi|3241888|dbj|BAA28889.1|_2:377 cytochrome b [Sus scrofa]. gi|7648613|gb|AAF65611.1|_2:378 cytochrome b [Otomys irroratus]. gi ... http://protea.worldonline.co.za/picking.htm Protea Picking: Occasionally, picking may even not be by human agents, as in the case of predation by Otomys irroratus (as may have been the case in the record for Serruria ... http://www.parksnorthwest.co.za/pilanesberg/pilanesberg_animals.html Animal Checklist: Pilanesberg National Park in the North West ...: Otomys angoniensis, English Setswana Afrikaans, Angoni vlei rat Nthufe Angoni-vleirot. Otomys irroratus, English Setswana Afrikaans, Angoni vlei rat Peba Vleirot. ... http://mossie.cs.und.ac.za/~murrellh/conservancy/mammals.html msinsi mammals: Epomophorus sp. Wahlberg's epauletted fruit bat. Otomys irroratus, Vleirat. Common Visitors. Cercopithecus aethiops, Vervet monkey. Mungos mungo, Banded mongoose. ... http://www.esapubs.org/archive/ecol/E084/094/MOMv3.3.txt AF extant Artiodactyla Bovidae Addax nasomaculatus 4.85 70000.3 60 ...: ...- [ Translate this page ] ... Rodentia Muridae Otomys unisulcatus 2.1 124.5 60 AF extant Rodentia Muridae Otomys denti 2.08 120 135 AF extant Rodentia Muridae Otomys irroratus 2.01 101.8 ... http://www.mujweb.cz/Veda/traxler/rongul.htm ordo : RONĜULOJ - Rodentia - hlodavci: ...genro : otomuso - Otomys. specio : otomuso lameldenta - Otomys irroratus - myš lamelozubá. subfamilio : muzelmusenoj - Rhynchomyinae - nosaté myši. ... http://www.pubmedcentral.nih.gov/articlerender.fcgi?artid=59666 Isozyme and allozyme markers distinguishing two morphologically ...: Johnson and Selander [12] obtained 7.9% in the Heteromyid Dipdomys, 17.4% for Otomys irroratus[13], 16.1% for Rhabdomys pumilio[14], and 6.7% for Oryzomys ... http://www.bionet.nsc.ru/chromosomes/rodentia/references.htm Elobius talpinus Pallas: Genetic variation in the African rodent subfamily Otomyinae (Muridae). II. Chromosomal changes in some populations of Otomys irroratus. Cytogenet. ... http://www.phthiraptera.org/Mammals/Muridae.html Mammals: Muridae: Otomys denti Thomas, 1906 - Dent´s Vlei Rat Polyplax otomydis Cummings, 1912. Otomys irroratus (Brants, 1827) - Vlei Rat Polyplax otomydis Cummings, 1912. ... http://www.science.smith.edu/departments/Biology/VHAYSSEN/msi/msibiblio.html Home | Search | About |
|
Copyright SpeciesList.com 2003-2009 |