|
Tachyoryctes splendens - East African Mole RatIUCN Status: Lower Risk/Least ConcernIUCN Species Profile http://www.omne-vivum.com/animals-and-plants/t.htm Omne vivum - Clickable index - Letter T: Tachyglossidae, Tachyglossus, Tachyglossus aculeatus, Tachyoryctes. Tachyoryctes splendens, Tachypleinae, Tachys, Tachysoma. Tachysurus, ... http://animaldiversity.ummz.umich.edu/site/accounts/classification/Tachyoryctes_splendens.html ADW: Tachyoryctes splendens: Classification: Tachyoryctes splendens (East African mole rat). ... Parent taxa. specimens. Genus Tachyoryctes (mole rats). Species Tachyoryctes splendens (East African mole rat). ... http://animaldiversity.ummz.umich.edu/site/accounts/classification/Rhizomyinae.html ADW: Rhizomyinae: Classification: Rudd's mole rat). specimens. Species Tachyoryctes spalacinus (Embi mole rat). Species Tachyoryctes splendens (East African mole rat). ... http://www.press.jhu.edu/books/walkers_mammals_of_the_world/rodentia/images/image.rodentia.muridae.tachyoryctes.html Thumbnails Page, Rodentia Muridae Tachyoryctes: African mole-rat (Tachyoryctes splendens): Photo by P. Morris. African mole-rat (Tachyoryctes splendens): Photo from Museum Senckenbergianum. ... http://www.press.jhu.edu/books/walkers_mammals_of_the_world/refs/walker.ref-j.html Literature Cited, J: Fert., Suppl. 6:237-48. ___. 1973a. Activity patterns in the mole-rats Tachyoryctes splendens and Heliophobius argenteocinereus. Zool. Afr. 8:101-19. ___. ... http://www.americazoo.com/goto/index/mammals/185.htm East African mole rat: East African mole rat - TACHYORYCTES SPLENDENS. Possibly Endangered. Class: Animals with Milk Glands (Mammalia) Subclass: True Mammals ... http://www.uia.ac.be/bio/morfo/hall.html Hall of fame: Functioneel morfologische studie van het kauwen bij de afrikaanse molrat Tachyoryctes splendens - Functional analysis of chewing in Tachyoryctes splendens. ... http://www.chez.com/rodent/Muridae/Muridae.html Muridae: Revenir au début. Genus Phyllotis. Phyllotis darwini - Leaf-eared mouse -. Genus Tachyoryctes. Tachyoryctes splendens - East African mole-rat. Genus Deomys. ... http://www.bioone.org/bioone/?request=get-citation-links&doi=10.1043/0044-5096(1973)008%3C0101:APITMR%3E2.0.CO;2&id=I0022-2372-083-01-0153-JARVIS1&sitename=BIOONE Citation Links: CITATION Jarvis, JUM Activity patterns in the mole-rats Tachyoryctes splendens and Heliophobius argenteocinereus Zoologica Africana 1973 vol. 8, page 101. ... http://www.bioone.org/bioone/?request=get-citation-links&doi=0269-364X(1983)200%3C0071:BSMASO%3E2.0.CO;2&id=I0022-2372-084-01-0272-HICKMAN1&sitename=BIOONE Citation Links: CITATION Hickman, GC Burrow, surface movement, and swimming of Tachyoryctes splendens (Rodentia: Rhizomyidae) during flood conditions in Kenya Journal of ... http://ppathw3.cals.cornell.edu/mba_project/CIEPCA/exmats/tephrosia.html CIAT-Uganda's Tephrosia Extension Material: CONTROL ROOT. (MOLE) RATS. WITH TEPHROSIA. (MULUKU). Root rats (mole rats, enfuko, nfukuzi, Tachyoryctes splendens) are a major problem to farmers in Uganda. ... http://falcon.tamucc.edu/~ghickman/Research.htm Research: HICKMAN, GRAHAM C. 1983. Burrows, surface movement, and swimming of Tachyoryctes splendens (Rodentia: Rhizomyidae) during flood conditions in Kenya. ... http://www.savci.upol.cz/hlod-4.htm Rodentia - Hlodavci: ...ruddi Thomas, 1909 - hlodoun Ruddův - Rudd's Mole Rat Tachyoryctes spalacinus Thomas, 1909 - hlodoun - Embi Mole Rat Tachyoryctes splendens (Rüppell, 1835 ... http://www.up.ac.za/academic/acadorgs/zssa/journal/v8.html Zoologica Africana Vol 8 (1973): Zoologica Africana 8(1):91-100 Jarvis JUM. Activity patterns in the mole-rats Tachyoryctes splendens and Heliophobius argenteocinereus. ... http://www.wildcru.org/research/es/ethiopianwolf/ewcp/ewolf.htm EWCP - Ethiopian wolves: In locations where the giant molerat is absent it is replaced in the diet by the smaller common molerat, Tachyoryctes splendens. ... http://www.blackwell-synergy.com/links/doi/10.1046/j.1365-2028.2002.00374.x/abs/ Diet of Mackinder's eagle owl Bubo capensis mackinderi in the ...: In his study conducted on Mau Narok, Kenya, he found the African mole rat Tachyoryctes splendens Rüppell, 1836 to predominate in the diet, while Gargett & ... http://www.rodent.be/rodentnederlands/Taxonomie/muridae.htm Muridae: Tachyoryctes ruandae. Tachyoryctes ruddi. Tachyoryctes spalacinus. Tachyoryctes splendens. Subfamilie Cricetomyinae. Beamys. Beamys hindei. Beamys major. Cricetomys. ... http://www.rodent.be/rodentfrans/Taxonomie/muridae.htm Muridae: Tachyoryctes ruandae. Tachyoryctes ruddi. Tachyoryctes spalacinus. Tachyoryctes splendens. Genre Cricetomyinae. Beamys. Beamys hindei. Beamys major. Cricetomys. ... http://foxey.org/Animals/wolf_simemsis.html Canis simensis [Ethiopian wolf]: ...component of the diet. In its absence, the common mole-rat Tachyoryctes splendens is most commonly eaten. Canis simensis also eats ... http://www.sevin.ru/laboratories/orlov_pub.html ИÑ?Ñ?ледовательÑ?кие подразделениÑ? ...: Notes on the karyotype of Tachyoryctes splendens (Ruppell 1838) (Rodentia, Rhizomyidae) from Ethiopia // Tropical Zool., 6,1, 81-88. ... http://www.sevin.ru/publications/pub_main.html Публикации: адаптации пищеварительной Ñ?иÑ?темы африканÑ?кой бамбуковой крыÑ?Ñ‹ Tachyoryctes splendens. Ð’ кн. ... http://perso.club-internet.fr/boudetjo/ZooList/Mammif/ClasRode.html Classification des Rodentiens: Tachyoryctes macrocephalus Tachyoryctes naivashae Tachyoryctes rex Tachyoryctes ruandae Tachyoryctes ruddi Tachyoryctes spalacinus Tachyoryctes splendens. ... http://www.micro-genomes.mpg.de/cgi-bin/getblast.cgi?pir030305.orfprot.RB4417.blastp getblast.pl beck@molgen-mpg.de: 81 2e-14 SP_TREMBL:Q9HRJ9 Q9hrj9 halobacterium sp. (strain nrc-1). cytoch... 81 2e-14 SP_TREMBL:Q37691 Q37691 tachyoryctes splendens (east african mol... ... http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&list_uids=7752309&dopt=Citation Hyperalgesia following administration of morphine and pethidine in ...: Hyperalgesia following administration of morphine and pethidine in the root rat (Tachyoryctes splendens). Towett PK, Kanui TI. Department ... http://212.187.155.84/pass_06june/List_WPMod_Cont/FMD/Picornaviridae_FMDVirus/FMDVSppDefinitiveHost.html Foot and Mouth Disease - Definitive Host Species (Viral Reports): Prolonged detection of virus in urine/faeces samples (J42.80.w1). Tachyoryctes splendens - East African mole rat: Experimental infection (J65.11.w1). ... http://212.187.155.84/pass_06june/subdirectories_for_search/specieskingdoms/0Families_ACrM_Rodentia/Muridae/Tachyoryctes/Tachyoryctes_splendens/Tachyoryctes_splendens.html 212.187.155.84/pass_06june/subdirectories_for_search/specieskingdoms/0Families_ACrM_Rodentia/Muridae/Tachyoryctes/Tachyoryctes_splendens/Tachyoryctes_splendens.html: Similar pages Protected Areas Programme - ... The endemic mole-rat Tachyoryctes splendens is common throughout the northern slopes and the Hinde Valley at elevations up to 4,000m. Forest birds include ... http://www.unep-wcmc.org/sites/wh/mt_kenya.html Mammifères des parcs nationaux du Congo: ...- ... Paraxerus alexandri Pelomys fallax concolor Praomys jacksoni Protoxerus strangeri Rattus rattus Stochomys longicaudatus Tachyoryctes splendens Tatera validae ... http://www.esd.ornl.gov/facilities/genomics/partial_microarrays.html Partial Microarrays -- Dorothea Thompson: Synechocystis PCC6803}; cytochrome c oxidase subunit II {Tachyoryctes splendens}; cytochrome c peroxidase {Aquifex aeolicus}; cytochrome ... http://www.emporia.edu/biosci/msl/rodent.htm MSL, Order Rodentia: LL Master Tachyoryctes splendens - East African mole-rat - E Africa; 696 Oblique view, 1981. GC Hickman; 697 Side view of mole-rat digging, 1981. ... http://www.garfield.library.upenn.edu/histcomp/ayala-fj_w-citing/index-lcs-20.html HistCite - index: 330 papers and books by FJ Ayala <br> (including ...: 112(3):167-179 MAINA JN; MALOIY GMO; MAKANYA AN MORPHOLOGY AND MORPHOMETRY OF THE LUNGS OF 2 EAST-AFRICAN MOLE RATS, TACHYORYCTES-SPLENDENS AND HETEROCEPHALUS ... http://nema.cap.ed.ac.uk/nematodeESTs/Ascaris/Ascaris300-324/Asmc-319xnr.html National Center for Biotechnology Information (NCBI) welcome to ...: Sbjct: 168 GVKTDAIPGRLNQTSFITTRPGIFYGQCSEICGANHSYMPIVVESTPLTHFESW 221 gi|1480778 (U62575) cytochrome c oxidase subunit II [Tachyoryctes splendens] Length = 227 ... http://www.szp.swets.nl/szp/journals/em36s027.htm Ultrastructure of Major Intraglandular Ducts in the Parotid Gland ...: Biological Sciences, Lubbock, USA. The parotid gland of a female African mole-rat, Tachyoryctes splendens, was examined by light and electron microscopy. ... http://industry.ebi.ac.uk/~alan/BioWidget/Taxonomy/tax4.data 1 root 1 2759 Eukaryotae 1 42452 unclassified eukaryotes 2759 ...: 33553 10165 Ctenodactylus 10164 10166 Ctenodactylus gundi 10165 10066 Muridae 33553 49444 Tachyoryctes 10066 49445 Tachyoryctes splendens 49444 40140 ... http://www.phthiraptera.org/Mammals/Muridae.html Mammals: Muridae: Tachyoryctes splendens (Rüppell, 1835) - East African Mole Rat. Sigmodontinae. Abrawayaomys. Abrawayaomys ruschii Cunha and Cruz, 1979 - Ruschi´s Rat ... http://bioinfo.hku.hk/db/cutg/gbrod.spsum Acomys cahirinus: 2 1 12 8 4 1 4 2 7 11 3 1 6 3 12 2 3 13 2 5 16 2 ...: 10 7 0 4 0 0 20 6 0 1 14 3 2 3 10 9 0 5 10 9 3 5 11 4 1 2 8 1 12 5 6 0 8 4 6 0 9 3 10 6 3 0 19 8 11 26 19 4 0 1 0 11 Mitochondrion Tachyoryctes splendens: 2 7 ... http://www.infobiogen.fr/db/cutg/CUTG/gbrod.spsum Abrothrix jelskii: 1 0 2 1 0 1 0 1 1 4 2 1 1 1 7 0 4 6 0 1 5 0 2 2 ...: 10 7 0 4 0 0 20 6 0 1 14 3 2 3 10 9 0 5 10 9 3 5 11 4 1 2 8 1 12 5 6 0 8 4 6 0 9 3 10 6 3 0 19 8 11 26 19 4 0 1 0 11 mitochondrion Tachyoryctes splendens: 2 7 ... http://www.nouvellesapproches.org/PKB/faune/mamal_fr.htm [an error occurred while processing this directive] Tachyoryctes splendens [an error occurred while processing this directive] 21299 East African Mole Rat East African Mole Rat Home | Search | About |
|
Copyright SpeciesList.com 2003-2009 |