|
|
Sargocentron tierePicturesFishbase Species Profile for Sargocentron tiere http://species.fishindex.com/photo_34420sargocentron_tiere.html Sargocentron tiere -: Species Profiles > Saltwater Fish > Squirrelfish and Soldierfish > Sargocentron tiere. Photo for Sargocentron tiere. Photo Copyright: john_e_randall. ... http://www.funet.fi/pub/sci/bio/life/pisces/actinopterygii/beryciformes/holocentridae/holocentrinae/sargocentron/ Sargocentron: Sargocentron tiere Shimizu, 1984 Holocentrum tiere Cuvier, 1829; (valid as) Perca holocentrus Forster, 1844; (synonym) Holocentrum poecilopterus Bleeker, 1854 ... http://www.funet.fi/pub/sci/bio/life/warp/fish-index-p-n.html All (in this database) Fish list (Scientific names): ...poecilopterus; poecilopterus (Exocoetus), see Cypselurus poecilopterus; poecilopterus (Holocentrum), see Sargocentron tiere; poecilopterus ... http://www.livingreefimages.com/Page7.html LIVING REEF IMAGES (Squirrelfishes, Soldierfishes): ...________________________________ Name: Sargocentron tiere. Popular name: Palau Squirrelfish. Range: Indo-West Pacific. Size: 30cm (12 inches). ... http://www.livingreefimages.com/index(d).html LIVING REEF IMAGES (Species index): Muraenidae. Echidna nebulosa Gymnomuraena zebra. Beryciformes. Holocentridae. Sargocentron tiere. Syngnathiformes. Aulostomidae. Aulostomus chinensis. Syngnathidae. ... http://www.fishbase.org/Summary/SpeciesSummary.cfm?&genusname=Sargocentron%09%09&speciesname=tiere www.fishbase.org/Summary/SpeciesSummary.cfm?&genusname=Sargocentron%09%09&speciesname=tiere: Similar pages Species SummarySargocentron tiere Blue lined squirrelfish, You can sponsor this page, ... http://www.fishbase.org/Summary/SpeciesSummary.cfm?ID=4908&genusname=Sargocentron&speciesname=tiere National Park of American Samoa: Fishes of Nationa Park of American Samoa. Squirrelfishes. Sargocentron tiere. blue-lined squirrelfish. photo © Richard C. Wass. Family ... http://www.nps.gov/npsa/NPSAfish/family/holocent.htm NPSpecies Report: Sargocentron tiere, blue-lined squirrelfish, Sargocentron tiere. blue-lined squirrelfish, 166264, Probably Present, No data, No data, Native. ... http://www.infochembio.ethz.ch/links/zool_fische_schleimkoepfe.html Schleimköpfe: Fische: Blue Lined Squirrelfish (Sargocentron tiere) - Text and Image. Blue Lined Squirrelfish (Sargocentron tiere) - Text and Images. Brachypterois serrulata - Image. ... http://www.hrw.com/science/si-science/biology/animals/fish/albatross/illusito.html Kumataro Ito Illustrations: The annotations have been provided by David G. Smith. picture of Sargocentron tiere, Sargocentron tiere(Cuvier, 1829); squirrelfish. ... http://fishdb.sinica.edu.tw/2001new/fishpic.asp?gen=Sargocentron&spe=tiere Sargocentron tiere: ...å¸å??, Sargocentron tiere, 命å??者, (Cuvier, 1829). ä¸æ–‡å??, 赤é°æ£˜é±—éš. 科ä¸æ–‡å??, 金鱗éšç§‘. 科號科å??, 269 Holocentridae. ... http://fishdb.sinica.edu.tw/2001new/fishname.asp?fa=Holocentridae 臺ç?£åœ°å?€ 金鱗éšç§‘ 計有éšç¨®31 種: Sargocentron spiniferum, å°–å?»æ£˜é±—éš, Sargocentron ensifer, åŠ?棘鱗 éš, Sargocentron tiere, 赤é°æ£˜é±—éš, Sargocentron rubrum, 黑帶棘 é°éš, ... http://www.coralreefnetwork.com/stender/fishes/squirrelfishes/squirrel.htm Squirrelfishes and Soldierfishes: An uncommon solitary species in Hawaii. Sargocentron tiere. TAHITIAN SQUIRRELFISH ALA'IHI Aosuji-ebisu. All fins reddish; spiny dorsal tipped with white. ... http://www.coralreefnetwork.com/kona/design.htm WHAP: West Hawai'i Aquarium Project: 0.09. 0.29. 0.11. 132. Sargocentron spp. 0.22. 0.67. 0.27. 123. Sargocentron tiere. 0.04. 0.21. 0.08. 191. Sargocentron xantherythrum. 0.26. 0.69. 0.27. 105. Saurida gracilis. ... http://www.liveaquaria.com/product/categ.cfm?siteid=21&pCatId=42 Squirrelfish: Lanka, Glass Eye Squirrelfish Glass Eye Squirrelfish (Heteropriacanthus cruentatus) Hawaii, Scarlet Fin Soldier Scarlet Fin Soldier (Sargocentron tiere) Tahiti. ... http://www.itis.usda.gov/servlet/SingleRpt/RefRpt?search_type=publication&search_id=pub_id&search_id_value=1676 ITIS 'Publication' Search results for Randall, John E.: Sargocentron spinosissimum (Temminck and Schlegel, 1843) -- valid. Sargocentron tiere (Cuvier in Cuvier and Valenciennes, 1829) -- valid. ... http://club.pep.ne.jp/~bigfish/fishes/moku/Beryciformes.htm ã‚ンメダイ目 Beryciformes: Sargocentron suborbitalis, (Gill, 1863), Tinsel squirrelfish. Sargocentron tiere, (Cuvier, 1829), Bluelined squirrelfish. Sargocentron ... http://www.biosis.org.uk/ion/results.asp?seek=Sargocentron%20tiere Search results: Results. Request Details. Searching for : Sargocentron tiere. Search Results. ... Database. Organism Name, Group. Sargocentron tiere, Pisces. Search again. ... http://www.hawaii.edu/loseylab/ocular50.htm ocular50's: Sargocentron spiniferum. 395. 375. Sargocentron spiniferum. 387. 374. Sargocentron tiere. 384. 369. Fistulariidae. Fistularia comersonii. 410. 411. Fistularia comersonii. ... http://www.hawaii.edu/ssri/hcri/text_only/rbi/hawaii/kapoho_point.htm Hawaii Coral Reef Initiative Research Program: 0.1. 0.2. Sargocentron spiniferum. 0.1. 0.1. Sargocentron spp. 0.1. 0.2. Sargocentron tiere. 0.3. 0.4. Saurida gracilis. 0.0. 0.1. Scarus dubius. 0.0. 0.1. ... http://www.kt.rim.or.jp/~yukay/mal_fg.htm FISHES of the MALDIVES å¦å??å’Œå??対照表: 41, Sargocentron microstoma, ヒメエビス？. 42, Sargocentron diadema, ニ ジエビス. 42, Sargocentron tiere, アオスジエビス. 42, Sargocentron tiereoides, ... http://www.iimi.org/ICLARM/fishbase/Summary/SpeciesSummary.cfm?ID=4908&genusname=Sargocentron&speciesname=tiere www.iimi.org/ICLARM/fishbase/Summary/SpeciesSummary.cfm?ID=4908&genusname=Sargocentron&speciesname=tiere: Similar pages Australian Fish Species ... Sargocentron rubrum (ForsskÃ¥l, 1775). Sargocentron spiniferum (ForsskÃ¥l, 1775). Sargocentron tiere (Cuvier, 1829). Sargocentron tiereoides (Bleeker, 1853). ... http://amol.org.au/collection/hostedwebs/fish/key/fish_species_listC.html Organisms of Hawaii -- Images: Google images ] Sargocentron spiniferum -- (Beryciformes: Holocentridae) [ BISH info ] [ Google images ] Sargocentron tiere -- (Beryciformes: Holocentridae ... http://www.hear.org/images/organisms/hawaii/fish/order_b.htm Organisms of Hawaii -- Images: Beryciformes: Holocentridae) -- Sargocentron spiniferum [ BISH info ] [ Google images ] (Beryciformes: Holocentridae) -- Sargocentron tiere [ BISH info ... http://www.fishbase.org.ph/map/PointData.asp?genus=Sargocentron&species=tiere 4908 Sargocentron tiere (Cuvier, 1829) Holocentridae ...: ...- [ Translate this page ]] > 4908 Sargocentron tiere (Cuvier, 1829) Holocentridae Squirrelfishes, soldierfishes Holocentrinae Beryciformes Actinopterygii (ray-finned fishes) Blue lined ... http://www.diving4images.com/resources.html Diving 4 Images - Indonesia Marine Life Education Resources: GIANT SQUIRRELFISH, SARGOCENTRON SPINIFERUM. BLUELINE SQUIRRELFISH, SARGOCENTRON TIERE. PINK SQUIRRELFISH, SARGOCENTRON TIEROIDES. VIOLET ... http://homepage1.nifty.com/ose/text/fishlist-maldive.htm 種å??: 607, アオスジエビス, Sargocentron tiere, Blue-lined squirrelfish, 014-09, 42, 166, 608, サクラエビス, Sargocentron tiereoides, Pink squirrelfish, 014-10, 42, ... http://ch.expasy.org/cgi-bin/get-entries?OC=Sargocentron%20tiere%20(Blue%20lined%20squirrelfish) ch.expasy.org/cgi-bin/get-entries?OC=Sargocentron%20tiere%20(Blue%20lined%20squirrelfish): Similar pages Search resultSearch result You searched for distribution of Sargocentron tiere your search returns 129 results. about the data sources Data Downloading ... http://www.iobis.org/pls/OBISIND/obis_data.get_obis_data?genus=Sargocentron&species=tiere PRESAGE : Search results: Other IDs: pacc: AAB39534.1. Species: Sargocentron tiere. Description: Rhodopsin (fragment). Comments (from SWISS-PROT, copyright ): ... http://filaman.uni-kiel.de/Nomenclature/NominalSpeciesList.cfm?family=Holocentridae Information by Country - Search Result: 049349. Holocentrum elongatum Bliss, 1883, Sargocentron tiere, 027370. Adioryx elongatus (Bliss, 1883), Sargocentron tiere, 033390. Holocentrus ... http://filaman.uni-kiel.de/Photos/PhotosList.cfm?requesttimeout=3600&id=287%09&vCollaborator=Michael%20N.%20Trevor Information by Country - List of Photographs: ...jpg. Sargocentron, spiniferum, Marshall Is, Majuro, 01-10-97, Saspi_u1.jpg. Sargocentron, tiere, Marshall Is, Satie_u2.jpg. Sargocentron, violaceum, ... http://www.chickest.udel.edu/orthohuman/h344.html BLAST Search Results: 289 3e-76 gb|U57537.1|SDU57537 Sargocentron diadema rhodopsin mRNA, c... 288 4e-76 gb|U57545.1|STU57545 Sargocentron tiere rhodopsin mRNA, par... ... http://www.chickest.udel.edu/orthomouse/m344.html BLAST Search Results: 293 2e-77 gb|AF201470.1|AF201470 Salmo salar retinal rod opsin mRNA, ... 293 2e-77 gb|U57545.1|STU57545 Sargocentron tiere rhodopsin mRNA, par... ... http://www.gpcr.org/7tm/seq/DR/OPSD_SARTI.TABDR.html GPCRDB Cross References for OPSD_SARTI: Description, Rhodopsin (Fragment). Gene, RHO. Organism, Sargocentron tiere (Blue lined squirrelfish). Chromosomal location, -. Gene Ontology, QuickGO. ... http://genstyle.imed.jussieu.fr/chaosgame/affichage_esp_list.php?lettres=s Alphabetical List of Species: ...- [ Translate this page ] ... Sargocentron sp (4). Sargocentron spiniferum (1). Sargocentron tiere (1). Sargocentron xantherythrum (1). Sarkidiornis melanotos (6). Sarota sp (1). ... http://ichtyonb1.mnhn.fr/identification/specieslist.cfm?famcode=243&areacode= Family - Search Result: Sargocentron suborbitalis, Tinsel squirrelfish, 25.4 TL. Sargocentron tiere, Blue lined squirrelfish, 33.0 TL. Sargocentron tiereoides, Pink squirrelfish, 17.0 TL. ... http://ichtyonb1.mnhn.fr/Nomenclature/SynonymSummary.cfm?ID=25376&genusname=Sargocentron&speciesname=tiere ichtyonb1.mnhn.fr/Nomenclature/SynonymSummary.cfm?ID=25376&genusname=Sargocentron&speciesname=tiere: Similar pages[ More results from ichtyonb1.mnhn.fr ] Aquariozone : l'aquariophilie marine et récifale plus de 400 ... ... ringens x Cirripectes alboapicalis Callionymus fasciatus Chaetodon jayakari x Amblyeleotris aurora xx Haemulon serrula Sargocentron tiere x Bodianus hirsutus ... http://membres.lycos.fr/aquariozone/ Links to Aquarium Websites: Bluelined squirrelfish(Sargocentron tiere); Sargocentron xantherythrum. Squirrelfishes, soldierfishes (Holocentridae): Genus list ... http://www.biologybrowser.org/cgi-bin/search/hyperseek.cgi?Terms=Sargocentron%20tiere Resources from www.BiologyBrowser.org: Home > Searched ... Any Term Entire collection. How we searched.... Optional: sargocentron tiere No links available for this search. ... http://fish-broker.net/family.asp?Family=Squirrelfish Fish-Broker.net: Big Eye Hawaii, Sargocentron sp. Glass Eye, Heteropriacanthus cruentatus. Scarlet Fin Soldier, Sargocentron tiere. Stripped, Sargocentron xantherythrus. http://eyesite.cryst.bbk.ac.uk/family70/70.fasta gi|5870751|gb|AAD54573.1|AF137207_1 AF137207 rhodopsin ...: Rhodopsingi|1762414|gb|AAB39534.1| U57545 rhodopsin [Sargocentron tiere] TEGPDFYIPMVNTTGVVRSPYEYPQYYLVNPAAFAVLGAYMFFLIIIGFPINFLTLYVTLEHKKLRTPLNYILLNLAVAD ... http://eyesite.cryst.bbk.ac.uk/family70/ FAMILY 1 OF G-PROTEIN COUPLED RECEPTORS, subfamily Opsins: GenBank entry >gi|3024307|sp|P79911|OPSD_SARTI Rhodopsingi|1762414|gb|AAB39534.1| U57545 rhodopsin [Sargocentron tiere]. GenBank ... http://bio.cigb.edu.cu/srs7bin/cgi-bin/wgetz?-id+1JfFE1LdRhZ+%5Bswissprot-ID:opsd_sarti%5D+-e Entry Page: 36, Last sequence update) DT 28-FEB-2003 (Rel. 41, Last annotation update) DE Rhodopsin (Fragment). GN RHO. OS Sargocentron tiere (Blue lined squirrelfish). ... http://srs.pku.edu.cn/srs7bin/cgi-bin/wgetz?-id+4xSrM1MJWdV+%5Bswissprot-AccNumber:P79911%5D+-e Entry Page: 36, Last sequence update) DT 10-OCT-2003 (Rel. 42, Last annotation update) DE Rhodopsin (Fragment). GN RHO. OS Sargocentron tiere (Blue lined squirrelfish). ... http://bighost.area.ba.cnr.it/srs6bin/wgetz?-e+%5BTAXONOMY:'8727'%5D TAXONOMY:8727 ID : 47713 PARENT ID : 47707 RANK : species GC ID ...: TAXONOMY:8727 ID : 47713 PARENT ID : 47707 RANK : species GC ID : 1 MGC ID : 2 SCIENTIFIC NAME : Sargocentron tiere // http://www.biodiversity.org.uk/fish-bin/fishref.pl?speccode=4908 FishBase WWW:Reference: FishBase WWW: Reference. Sargocentron tiere. Abu Khair Mohammad Mohsin, Mohd. Azmi Ambak, and Muhamad Nasir Abdul Salam1993 Malay, English ... http://genome.jgi-psf.org/cgi-bin/dispGeneModel.v4?db=ciona4&id=154564 Protein Pages: Ciona intestinalis (Sea Squirt): ...genome.jgi-psf.org/cgi-bin/ dispGeneModel.v4?db=ciona4&id=154564 - 21k - Cached - Similar pages HAW Species & Family Distribution Reportwww.reef.org/data/haw/scispecies.shtml - 21k - Cached - Similar pages JD RACINE _< UNCLASSIFIED × Ã2 _< ÿÿÿü UNCLASSIFIED. ... - [ Translate this page ] ... 7Q SARGOCENTRON MICROSTOMA à œ _D 5 SARGOCENTRON PUNCTATISSIMUM Ä Ã…â€? _D H$ SARGOCENTRON SPINIFERUM Ã… Å• _D ?> SARGOCENTRON TIERE Æ Ã… ... http://www.reef.org/data/haw/scispecies.shtml HAW Species & Family Distribution Report: ...www.reef.org/data/haw/scispecies.shtml - 21k - Cached - Similar pages JD RACINE _< UNCLASSIFIED × Ã2 _< ÿÿÿü UNCLASSIFIED. ... - [ Translate this page ] ... 7Q SARGOCENTRON MICROSTOMA à œ _D 5 SARGOCENTRON PUNCTATISSIMUM Ä Ã…â€? _D H$ SARGOCENTRON SPINIFERUM Ã… Å• _D ?> SARGOCENTRON TIERE Æ Ã… ... http://www.infobiogen.fr/db/acnuc/hovergen/genomic/index/SPECIES JD RACINE _< UNCLASSIFIED × Ã2 _< ÿÿÿü UNCLASSIFIED. ...: ...- [ Translate this page ] ... 7Q SARGOCENTRON MICROSTOMA à œ _D 5 SARGOCENTRON PUNCTATISSIMUM Ä Ã…â€? _D H$ SARGOCENTRON SPINIFERUM Ã… Å• _D ?> SARGOCENTRON TIERE Æ Ã… ... http://www.infobiogen.fr/db/index-acnuc/HOVERGEN_44/protein/index/SPECIES OH RACINE Pâ€?Þ UNCLASSIFIED Pâ€?à ÿÿÿü UNCLASSIFIED. ...: ...- [ Translate this page ] ... DIADEMA K PÂ?Ëœ SARGOCENTRON MICROSTOMA K PÂ?Å¡ !Æ’ SARGOCENTRON PUNCTATISSIMUM K PÂ?Å“ KÂ? SARGOCENTRON SPINIFERUM K PÂ?ž <n SARGOCENTRON TIERE K P ... http://impact.nihs.go.jp/cgi-bin/refview/gb.STU57545 Reference: gb = STU57545: ...[ LinkDB ] LOCUS STU57545 1467 bp mRNA linear VRT 02-JAN-1997 DEFINITION Sargocentron tiere rhodopsin mRNA, partial cds. ACCESSION ... http://www.epa.gov/fedrgstr/EPA-IMPACT/2004/February/Day-24/i3851.htm EPA: Federal Register: Fisheries Off West Coast States and in the ...: ...squirrelfish (Sargocentron diadema) Peppered squirrelfish (Sargocentron punctatissimum) Blue-lined squirrelfish (Sargocentron tiere) Hawaiian squirrelfish ... http://search.iis.sinica.edu.tw/scripts/fish/index.asp?CID=3158&View= FishSearch - Holocentridae: ...punctatissimum (2). Sargocentron rubrum (2), Sargocentron spiniferum (2), Sargocentron spinosissimum (2). Sargocentron tiere (2), Contact Us, ... http://us.expasy.org/cgi-bin/get-entries?OC=Sargocentron%20tiere us.expasy.org/cgi-bin/get-entries?OC=Sargocentron%20tiere: Supplemental Result - Similar pages [DOC] ann92File Format: Microsoft Word 6 - View as HTMLDIVISION OF MARINE RESOURCES. ANNUAL REPORT. 1992. BUREAU OF RESOURCES AND DEVELOPMENT. MINISTRY OF RESOURCES AND DEVELOPMENT. PALAU. PREFACE. ... http://www.geocities.co.jp/Athlete/1528/fish_idx/fish_idx02.htm Sargocentron tiere --> 4908 --> Sargocentron tiere --> Home | Search | About | Contact 
|
|
Copyright SpeciesList.com 2004 |